PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G238900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 464aa    MW: 52445.5 Da    PI: 7.2368
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G238900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-18271318148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+WT+eEd+llvd++k+ G g+W++ ++  g++R++k+c++rw +yl
  Sevir.8G238900.2.p 271 KGPWTPEEDKLLVDYIKENGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 318
                         79********************************************97 PP

2Myb_DNA-binding50.26.1e-16324369148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         r+ +T eE++l++++   lG++ W++Ia +++ gRt++++k++w+++l
  Sevir.8G238900.2.p 324 RDHFTDEEEKLIIHLLSILGNK-WSSIAPKLP-GRTDNEIKNYWYTHL 369
                         6789******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF078875.4E-3764206IPR012416CALMODULIN-BINDING PROTEIN60
PROSITE profilePS5129425.333266322IPR017930Myb domain
SuperFamilySSF466897.91E-30268365IPR009057Homeodomain-like
SMARTSM007175.0E-15270320IPR001005SANT/Myb domain
PfamPF002497.3E-17271318IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-23272325IPR009057Homeodomain-like
CDDcd001673.71E-11273318No hitNo description
PROSITE profilePS5129420.494323373IPR017930Myb domain
SMARTSM007178.2E-16323371IPR001005SANT/Myb domain
PfamPF002493.7E-14324369IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-24326373IPR009057Homeodomain-like
CDDcd001677.79E-12327369No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006950Biological Processresponse to stress
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MPLPKFNNCG LPTTRLMQEH LDSLTIISKE VMQIRRNRGV IIEPLEPDDS DEERQLKRKM  60
RSKYKLRFVN KVCGAYHTRD PIKADDGSPL KVALFDENNI KITYGPLSSA SVQIVVLHGD  120
FNDHGQDYWT SEEFSRYEVC PRSGEVVLGG NCILVLADGE ACLGDAFFQM TSYCARTAKF  180
KMGIRLASAQ EERIQEGVSE QFWVKYRHFA GKALVDNDYQ EQNNPMPNLP YRSQINAGNR  240
LDIIWGRSQL PFPGSNMLST EPSTSDASVK KGPWTPEEDK LLVDYIKENG HGSWRRLPKL  300
AGLNRCGKSC RLRWTNYLRP DIKRDHFTDE EEKLIIHLLS ILGNKWSSIA PKLPGRTDNE  360
IKNYWYTHLR KKLLSRGIDP VTHRPPNLLA GIPNLLAAGI PNLAAAAQTT WDISTPCGEK  420
TPASSPFEGL GNLNLDDEFN SDSSCRDLLE QMSWLNNPNE QQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-252713737108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7276651e-114KJ727665.1 Zea mays clone pUT5592 MYB transcription factor (MYB148) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979956.11e-149PREDICTED: uncharacterized protein LOC101785879 isoform X4
TrEMBLK3ZPU81e-129K3ZPU8_SETIT; Uncharacterized protein
STRINGSi028628m1e-129(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.24e-63myb domain protein 9